HORDB

ID: hor004746
Uniprot ID: Q9SV72
Protein name: EPIDERMAL PATTERNING FACTOR-like protein 9
Gene name: EPFL9
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: Plant cysteine rich small secretory peptide family, Epidermal patterning factor subfamily
Source: Plant
Expression: Expressed in immature organs, including leaves, stems and flower buds, but not in roots, shoot apical meristem and petals. Detected in the mesophyll tissues but not in the epidermal tissues where stomata develop.
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005102 signaling receptor binding; GO:0019901 protein kinase binding; GO:0033612 receptor serine/threonine kinase binding
GO BP: GO:0007267 cell-cell signaling; GO:0010052 guard cell differentiation; GO:0010374 stomatal complex development; GO:0010375 stomatal complex patterning; GO:2000038 regulation of stomatal complex development; GO:2000123 positive regulation of stomatal complex development
GO CC: GO:0005576 extracellular region; GO:0048046 apoplast

Sequence: SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR
Length: 71(32-102)
Propeptide: MKHEMMNIKPRCITIFFLLFALLLGNYVVQASRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR
Signal peptide: MKHEMMNIKPRCITIFFLLFALLLGNYVVQA
Modification: NA
Glycosylation: NA
Mutagenesis: 34-34C->S: Incorrect disulfide bonds formation and loss of activity; 39-39C->S: Incorrect disulfide bonds formation and loss of activity; 42-42C->S: Incorrect disulfide bonds formation and loss of activity; 46-46C->S: Incorrect disulfide bonds formation a

Function: [Stomagen]: Positively regulates stomatal density and patterning. Acts by competing with EPF2 (AC Q8LC53) for the same receptors, ERECTA (AC Q42371) and TMM (AC Q9SSD1). Not cleaved by the protease CRSP (AC Q9LNU1) (PubMed:25043023).
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor004746_AF2.pdb

hor004746_ESM.pdb

Mass:	945106	Formula:	C344H555N117O103S7
Absent amino acids:	FW	Common amino acids:	R
pI:	9.12	Basic residues:	15
Polar residues:	28	Hydrophobic residues:	15
Hydrophobicity:	-75.63	Boman Index:	-21195
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	63.1
Instability Index:	7726.48	Extinction Coefficient cystines:	6335
Absorbance 280nm:	90.5